Plant Transcription factor database - Universität Potsdam
version: 3.0

Oryza sativa subsp. japonica Transcription Factor Database


>LOC_Os11g06420.1 [Oryza sativa subsp. japonica] OsFBT13 - F-box and tubby domain containing protein, expressed protein sequence BLAST
MSFRSIVRDVRDGFGSLSRRGFEVRILGHRRGKSHGAVHELHDPVPVIQSSCWASLPPELLRDIIERLEESEATWPSRKH
VVACAGVCRTWREMCKEIVKNPELCGKITFPISLRQPGPRDGTMQCFIRRDKSTQTYYLYLSLGSAVLVDNGKFLLSAKR
NWHATCTEYVISMNANNLSRSTNTNIGKLRSNFLGTKFVIYDTHTPYNATSDSQSGKTSRRFSNKGTAKHPCSTYSIANI
SYELNVFGTRGPRRMCCLMHSIPASSLEAGGTVPSQPDSILAHSLNESSFRSVSFSKSSVMDHSMHFSSAQFSDISIGDG
PRIGGRVLSDDEECKETPLILQNKAPRWHEQLQCWCLNFRGRVTVASVKNFQLIAATQPAAGAPTPSQPVPPPPPEHDKV
ILQFGKVAKDMFTMDYHYPLSAFQAFAISLSSFDTKLACE*