Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus tauri Transcription Factor Database


>12951 [Ostreococcus tauri]  fgenesh1_pg.C_Chr_11.0001000216 protein sequence BLAST
MSTAGRARADGAGENYMKPLARARGEGEGGTGGRERVTPRLSFVRRRDSAPVHPTLEDEGDADEGTGEGSAAASGANDGS
GARAGDDEGPPPSAPPAPRAGDARRRTPTPSVDDPMSCAAPLPPWADAGAKRRFTLRSLPNDGTHARCHVLRKRGLFGAF
PTYVLYLDGRETTTATLADAVPILVARKRKKAKCTHYVIGDDGAERAVNEAHPSYVGKLKANFIGTRFELFDAGARPRAW
GAPGHLGHASDDESDEDDDVPPRRTLANIRYAVNVLGVAGPRSLAVNVMDERGDTVTTALESARPRWNPSHQAYVLDFNG
RVTKPSVKNFQLAVVDSAEAEAAAEANRTSRRVVAQFGRVDDDLFTLDFAHPLGPLTAFAACLSTFESKIGCDDPSYEGD
GRVGESTIVGAGLGVFATRRLPRGSTARGVTYGGDVMTLLEAVAMPKKDKAYVMALHLNVHVDARRHYGYVGRYVNDSAG
TANALNAEFVKDAANRRATLRTVRDVEAGEEFFAAYGKGYWERERAIEGDGVATVERSDDG*