Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>4762933 [Sorghum bicolor]  estExt_Genewise1.C_chr_68718 protein sequence BLAST
MSFRSMVRDIRESFGNISRRNFEVRIHHRGKSLGSSSDLQDKPAEIQQSRWASLPPELLRDVMKRLEEDDSSWPDRKDVV
CCASVCTTWRDMCKDIVRSPEHCAKLTFPISLKQPGPRDGVIQCFIKRDKSKLTYRLYLSLSSAVLDENGKFLLAAKRSR
RMAHTEYAIFMGSRNFSRSSTGYIGKLRSNFLGTKFIIYDTQPPYNAGKLCAQERAPSRRLSSRKVSPRVPTGSYPIAQV
NYKLNVLGTRGPRRMQSAMHSIPASALEPGGVVPGQSKELLPRLFDESFSSTATSFSKYSVVDSSMDLISCRFSELIGGA
LEESSDDFEKERPLVLRNKAPRWHEQLQCWSLNFRGGVTVASVKNFQLIFSVPHPAPVGVFFAPPRGVTPPTQTQPQASG
PHVHDPVILHFGKVGRDIFPMDYRYPLWAFQAFAIFLRSLDPKLACE*