Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlamydomonas reinhardtii Transcription Factor Database


>144938 [Chlamydomonas reinhardtii]  Chlre2_kg.scaffold_12000132 protein sequence BLAST
MAGLTAAAAAVLGSASSGPGPVTTGLTHSGRSTPPGHATPPGQVTPPGQTTPERLRGAAGAAGAAGGGASAQLRHTPQWP
TGDAAMRAFHDVPRGAGADGAVKADAVAGSTAAGGAGSSGLASKSLFSQQQQQQQQQQQAQGAAPATGTLPDLDTGPMHE
SAGEDAEEGPDAYPDVHAPPGQARRPPQLRPPPADPQQQQQQQQLPEPIFVTVAASASKRPRNDRPGTSGAEGAAAGGGA
AAAAAEPHTAAGGGGGGTDSSPLRRTVVLGSFTLQLRSDLVCEVLGLFHPRRYVEGRDCVGGAVTAKWYRSIRVLPQMEH
LGDWLEAHGLQVFKGTGRKRGGRYGGGGSGDVLAMLALGAAAAGGAGSTGTGTEATAESEGPDMGAAVAATGAGMGLGAL
AAMPYSSRGAAAAALARAKPVDGDTAAAVAALAALSAAAAEGAAAPPASSAAAEAAAASSDGSEGPEGGSGDEAATAALA
AAAAHGSDDAAAAAEATSSHAQHWATAARGALQGTRSRSFGASSTAAAAAAAVAAEHWRSAGGGTQHWGSSSGGAGGGYS
HGQAGLLLPAASWPGPSPLGGGQRGQHGAPPRVSAPAATGSGSERGYELEARQAAVAATAAAAAADWLDTEHMPELQQQQ
QQQQQQQQQPLLALPAPPMTAAAGPSPPHGLLRGALEAAAAAAASSAAHGGGRQGAKGSPAVAAAAAAAAAAAAGGAAHH
EELPTRASGERLSAGGSPHHYQPHQYHQQHQQQQRLRRTAHQNHPHHQHASRASHGIGVSHPGQAVTSQSPAAATPPRRS
HGISTEALMPAAAANLLRSGGGGGGQLAGVGDGGALPTAFGAQLQWPPPGLEPGSRGAAAGAAAGQHTATPFAWAAAATA
PGVQVRPLVPRAGSKRRAEGAEDGEEGQQ*