Plant Transcription factor database - Universität Potsdam
version: 3.0

Chlamydomonas reinhardtii Transcription Factor Database


>20566 [Chlamydomonas reinhardtii]  fgenesh1_pg.C_scaffold_59000022 protein sequence BLAST
MPAWLALEIKRCLCLCGAVLVCIWLRTGRLRFAVSGLRRGCRRGRQEVAMFARLQEGTIRAWPCPAEHAAEAGERRRVKD
NAGKATVQLHQRTHLGDGILGAIGGADGADVMADLLHLMQGDIGNDADLLDGGVGVNGISHMGMEVVSAELAGHGLATAV
GPPPPQRQDSMDRLFDEVFGEGAAAAHDGAAAEADSRQRQLAAAAARSLTAAVGAGGTAAASTAAPSLATLSHFAVAGGG
SGGVEYGRLASVATAPATLGPQLQHSIYTTTHALYMSAGGVAAAVAVASPRNKRTAPGHERPPPPPPGAGPMPVPPQLMP
TRPHSHQQQQQPQQQQQQQQRQQQPQSLYPQRISGSGGEAGAGGGARMVGISNLGGGGGGGGGVSRLPAAAHTAPVAPST
LSDFYSAPQPVIAATATAIGTAGGGGRSRATATASFGYTADARGGGGLGGGGGGGGGGGPSRLVGLGLGPGRITRGGGGG
GGGPEAAAAAALMLPSGVVVGGEASSATLALAASFKRRRLDGKLGNALSLPLALAAGDDLAAASAPTSGGAAGGGGGAVR
LSGCGSVSGGSVPDADAAPLQSPMAPSLVPQWSLNGGAVPGAPQQQQQQQQQQQQQQQEMHHHRLHQQHHLFPSAQLCQH
PQQQQQQQLLLPQQSASMGLSLGSLGMSAGTMGTPRPQQQQAQQAQQQQQHLLADDAASRPGGGQTTGGGQTATGAGGGS
GGGGSVENPNLVDVAALAAGLDAFDMDVALLSKLDFDDEQNPTDHAGHQQQQQQQQHQQQQAQAQMQQQQQQQQQQQQQQ
QQQAQAQMQQQQQAQAQQQAQQQHLQQQQLLLQQQQQQQQQQQQQQQQQQQQMQQQMQGLQLQQQQPQPLLPSRKQLHLQ
QLMSYRSSSQPLQLQPPFQPPFQPPFQPPQQLRAYSAGQGWLTSLSGGGGGSATAAAAAALAAAAPGRLSSSSTAEMGMA
GAAQPPPQQLARSPSPLQQQQQQQQQQQQQPQMARRLSNTPSGGVGRSGTLSAGDTGDGLLAAGVGVGVGVGVGAGASGA
GLGAVGLQGVKPTSGVLGGATLSEQQQQQLASAQGTTRPAAMSSSGAATAATATTGGRKAAGGAASNPGTGTAAAAAATG
RRTGSAAAVSISSTSSGRQAGVSSSLGTAAAMPPPVTAAAAAAVAAARGLPVLRPAQLLQQHAHLVPPGVPDTLKVTVTG
GAAVPLKPPCALGGGGGEEEEKNNGGGEGGGGQGGGGGEGTAAATAAAAAAAAAAPPPVDPVEQLKADMAEVAALGGKVL
GVFYTGAYLDGGRCVEHCGELLSRSAFERVGGSSMAKWYRSIKVLPDGMSLGRWLLARGMPVLKGNPRQSRRRSRRNAEE
DEDEEEEEGEEAAAGGGSR