Plant Transcription factor database - Universität Potsdam
version: 3.0

Ostreococcus lucimarinus Transcription Factor Database


>26580 [Ostreococcus lucimarinus]  eugene.1100010253 protein sequence BLAST
MATTTTHGTRVYDDDAGDRPRRSYPHSTSRSTTTVAAHAPSSAHADGYRWRKYGQKNIKGSSFPRSYYRCTERGCPARKK
TELRRASEDGEMETVVCYEGEHTHAKPSGGGGRAETLAPGSTKSFGTRASGDSTATNARRGTTRFHDVCGGGGGGGKSSS
GQATESDAEDSAASEEDSTRTAVEHDETEALGVRKIAKWSSITDDVQRIRTVRARAPRILVQRRRGEEAETRRESAEPVV
RRHG*