Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5056731 [Sorghum bicolor]  Sb05g023730 protein sequence BLAST
MVADTESADSLPGSSNAASETPAHGSIHQKSQENPSKKTHKAEREKLKRDQLNDLFVELGSMLDLDRQNTGKATVLGDAA
RVLRDLITQVESLRKEQSALVSERQYVSSEKNELEEENNSLKSQISELQNELCTRLRNSSLNQNSLGMSLPVANTVGPDL
ATHPMPQQIWSNIPNLSSVSMAHPTNAATLLHSRDHSADAGQGYAPQPRELQLFPGASSSPERGCSGLGSDQPASSSLTD
SLPGQLCLSLPQSSQEGSSSGVVPRSRKEQRNG*