Plant Transcription factor database - Universität Potsdam
version: 3.0

Sorghum bicolor Transcription Factor Database


>5059794 [Sorghum bicolor]  Sb08g021000 protein sequence BLAST
MNQYISDWSGAMGDTFALPLGLGLVPIPTDHSIPFHFPTESMADAVRRRAAAAAAAVVVVCSGGGGGGEDDDGLIELMWC
NGHVVMQSQAAPRSNKPPRPDKAAPAAAAVQEDDDAAAQAWFQEQYPVEEEDPLERDDLFSELFGEAQAAVDGARGACSC
KEEAEEDARQSISGMMPPPPPMRPRDDKACTGDASLDAATATEGAESSMLTIGSSFCGSNHVQTTTGGAGTDVVVVVARA
RGAATDTSSATRSRSCTTRNEHPCPGAAAAAAAAHRSGKRKQSVDATDAEDVEFESADVTCEPAHKTATAKRRRAAEVHN
LSERRRRDRINEKMKALQELIPHCNKTDKASMLDEAIEYLKSLQLQLQMMWMGGGMAAAAAPVVFPAGVHQYMQRMVAAG
PAPPPHMASMPAMPFMAPPPAVQAPPLPDLYARYLAVDHHLPPLPPMVASPYTVELFFPTLMNLPIRTPPLLFADRFQQH
CLQSAMGFYQRQNPALPPLPAVPAPAPSPSDGILHKKYENCGKPEIQGITG*