Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT1G75390.2 [Arabidopsis thaliana]  ATBZIP44 (ARABIDOPSIS THALIANA BASIC LEUCINE-ZIPPER 44)  protein sequence BLAST
MNNKTEMGSSTSGNCSSVSTTGLANSGSESDLRQRDLIDERKRKRKQSNRESARRSRMRKQKHLDDLTAQVTHLRKENAQ
IVAGIAVTTQHYVTIEAENDILRAQDSVWRPVRDYSTVDYSTA*