Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT3G17609.4 [Arabidopsis thaliana]  HYH (HY5-HOMOLOG)  protein sequence BLAST
MSLQRPNGNSSSSSSHKKHKTAGSTCVLSSSADDGVNNPELDQTQNGVSTAKRRRGRNPVDKEYRSLKRLLRNRVSAQQA
RERKKVYVSDLESRANELQNNNDQLEEKISTLTNENTMLRKMLINTRPKTDDNH*