Plant Transcription factor database - Universität Potsdam
version: 3.0

Arabidopsis thaliana Transcription Factor Database


>AT5G44080.1 [Arabidopsis thaliana]  bZIP transcription factor family protein  protein sequence BLAST
MTSFQVMRSSNSRNSDLSRRISSASTSSSSIRPQQQFRRDLTSVGYGGRNDGLYSSNSMTVEGILHDTFASDPPAPTESS
LLDASINLMDASPAPMEITTTTASDVVDHGGGTETTRGGKSVDEIWREMVSGEGKGMKEETSEEIMTLEDFLAKAAVEDE
TAVTASAEDLDVKIPVTNYGFDHSAPPHNPFQMIDKVEGSIVAFGNGLDVYGGGARGKRARVMVEPLDKAAAQRQRRMIK
NRESAARSRERKQAYQVELEALAAKLEEENELLSKEIEDKRKERYQKLMEFVIPVVEKPKQQPPRFLRRIRSLEW*