Plant Transcription factor database - Universität Potsdam
version: 3.0

Alfin-like HMM

Sequence AAA20093 was used as a seed for a PSI BLAST search. The sequences aligning over the full length after the 4th iteration were kept, and aligned using ClustalX. The DNA-binding domain, similar to PHD, was extracted and an HMM was built.

CLUSTAL W(1.4) multiple sequence alignment


gi|50924564|ref CGACGEAYANGEFWICCDICETWFHGKCVRITPAKAEHIKHYKCPGC
gi|50909575|ref CGACGETYANGEFWICCDVCEKWFHGKCVRITPAKAEHIKQYKCPGC
gi|34907474|ref CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKQYKCPDC
gi|4091080|gb|A CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKQYKCPDC
gi|4884860|gb|A CGTCGTNDGKDEFWICCDNCEKWYHGKCVKITPARAEHIKQYKCPDC
gi|53982665|gb| CGSCGTNDGKDEFWICCDSCERWYHGKCVKITPARAEHIKHYKCPDC
gi|14192880|gb| CGACGESYGADEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSC
gi|50939155|ref CGACGESYGADEFWICCDICEKWFHGKCVKITPAKAEHIKQYKCPSC
gi|15239624|ref CGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSC
gi|3319341|gb|A CGACGESYAADEFWICCDLCEMWFHGKCVKITPARAEHIKQYKCPSC
gi|15229157|ref CGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSC
gi|75214624|gb| CGACGDSDGADEFWICCDLCEKWFHGKCVKITPARAEHIKQYKCPSC
gi|57222198|gb| CGACGDNYASDEFWICCDMCEKWFHGECVKITPARAEHIKHYKCPTC
gi|92892978|gb| CGACGDSNGADEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSC
gi|21593407|gb| CGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTC
gi|15226967|ref CGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTC
gi|15223786|ref CGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSC
gi|7262694|gb|A CGACGDNYGGDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPSC
gi|12651665|gb| CGACGDNYGTDEFWICCDMCEKWFHGKCVKITPAKAEHIKQYKCPGC
gi|63028790|gb| CGACGDNYATDEFWICCDICERWFHGKCVKITPAKAEHIKQYKCPSC
gi|29124114|gb| CGTCGGLYNANEFWIGCDICERWFHGKCVRITPAKAEHIKHYKCPDC
gi|50919441|ref CGTCGGLYNANEFWIGCDICERWFHGKCVRITPAKAEHIKHYKCPDC
gi|34900462|ref CGTCGGRYNANEFWIGCDICERWFHGKCVRITPAKAEHIKHYKCPDC
gi|50932231|ref CGTCGGIYSADEFWIGCDVCERWYHGKCVKITPAKAESIKQYKCPSC
gi|15239180|ref CGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSC
gi|15229696|ref CGSCGGHYTNEEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPPC
gi|45387429|gb| CGSCGTNGNEDEFWIGCDMCEKWYHGKCVKITPAKAQSIKEYRCPSC