Plant Transcription factor database - Universität Potsdam
version: 3.0

CCAAT-Dr1 HMM

The CCAAT-Dr1 domain is characteristic of the CCAAT-Dr1 transcription factor family. There are two sequences belonging to this family in Arabidopsis thaliana, a multiple alignment of the full length of both proteins was used to build an hmm, to find more members of this family

CLUSTAL W (1.8) multiple sequence alignment
 
 
At5g08190       MDPMDIVGKSKEDASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLISSESNE
At5g23090       MDPMDIVGKSKEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESND
                ******************************.**********************:*****:
 
At5g08190       VCNKEDKRTIAPEHVLKALQVLGFGEYVEEVYAAYEQHKYETMQDSQRSVKMNSGAEMTE
At5g23090       VCNKEDKRTIAPEHVLKALQVLGFGEYIEEVYAAYEQHKYETMQDTQRSVKWNPGAQMTE
                ***************************:*****************:***** *.**:***
 
At5g08190       EEAAAEQQRMFAEARARMNGGVTVPQPEQLEEPQQQQQTSLQS
At5g23090       EEAAAEQQRMFAEARARMNGGVSVPQPEHPETDQRSPQS----
                **********************:*****: *  *:. *: