Plant Transcription factor database - Universität Potsdam
version: 3.0

HRT HMM

Model based on the alignment from Raventos et al. 1998 Fig 1B, DNA-binding domain

CLUSTAL W(1.4) multiple sequence alignment


HRTdb1          vcgvmledgsscledpmegrkrcelhkgrr
X97909db1       icgvilddgsicskmpvgkrvrcnehkgmr
X97909db2       icgivledgttctttpvkgrkrctehkgkr
Y10013db1       acgvlledgttctttpvkxrkrctehkgkr
Y10013db2       icgvilpdmircrskpvsrrkrcedhkgmr
Y10013db3       lceattknglpctrsapegskrcwqhkdkt
HRTdb2          lcgvvtdng-ycklepvigrerceehrgie
Y10013db4       icgfklyngsvcekspvkgrkrceehkgmr
HRTdb3          vcgarasdgspcknqpiarrkrcalhkgqr