Plant Transcription factor database - Universität Potsdam
version: 3.0

LUFS HMM

Alignment of the LUFS domains from Conner & Liu (2000).

CLUSTAL W(1.4) multiple sequence alignment


NP_567896.1     LDVYIHDYLVKRDLKATAQAFQAEGKVSSDPV------------------
P40068          LNEYIFDFLTKSSLKNTAAAFAQDAHLDRDKGQNPVDGPKSKENNGNQNT
AF077048.1      LALYVYEYLLHVGAQKSAQTFLSEIRWEKNIT------------------
AC003974.3      LDVYIYDYLVKKKLHNTAKSFMTEGKVSPDPV------------------


NP_567896.1     ---AIDAPGGFLFEWWSVFWDIFIAR
P40068          FSKVVDTPQGFLYEWWQIFWDIFNTS
AF077048.1      ----LGEPPGFLHSWWCVFWDLYCAA
AC003974.3      ---AIDAPGGFLFEWWSVFWDIFIAR