Plant Transcription factor database - Universität Potsdam
version: 3.0

NF-YB HMM

The NF-YB domain is characteristic of the CCAAT_HAP3 transcription factor family. The alignment for the ProDom family PD002982 was used as seed alignment.

CLUSTAL W (1.82) multiple sequence alignment


P25208|CBFA_HUMAN-59-143           -------------LPIANVARIMKNAIP----Q-TGKIAKDAKECVQECV
P22569|CBFA_MOUSE-59-143           -------------LPIANVARIMKNAIP----Q-TGKIAKDAKECVQECV
Q63091|Q63091_RAT-21-105           -------------LPIANVARIMKNAIP----Q-TGKIAKDAKECVQECV
Q8C590|Q8C590_MOUSE-59-143         -------------LPIANVARIMKNAIP----Q-TGKIAKDAKECVQECV
Q9D056|Q9D056_MOUSE-21-105         -------------LPIANVARIMKNAIP----Q-TGKIAKDAKECVQECV
O73744|O73744_XENLA-58-142         -------------LPIANVARIMKNAVP----Q-TGKIAKDAKECVQECV
P25210|CBFA_PETMA-60-155           -------------LPIANVARIMKTSIP----S-SGKIAKDAKECVQECV
Q8WQQ1|Q8WQQ1_STRPU-60-157         -------------LPIANVARIMKDGIP----K-SGKISKEAKECVQECV
O59848|O59848_ASPOR-48-135         -------------LPIANVARIMKLALP----D-NAKIAKEAKECMQECV
Q00735|Q00735_EMENI-48-135         -------------LPIANVARIMKLALP----E-NAKIAKEAKECMQECV
Q86ZV5|Q86ZV5_ASPNG-49-136         -------------LPIANVARIMKLALP----E-NAKIAKEAKECMQECV
Q96WP0|Q96WP0_TRIRE-51-140         -------------LPIANVARIMKNALP----D-NAKIAKEAKECMQECV
P36611|PHP3_SCHPO-12-101           -------------LPIANVARIMKSALP----E-NAKISKEAKDCVQDCV
P25209|CBFA_MAIZE-36-125           -------------LPIANISRIMKKAIP----A-NGKIAKDAKETVQECV
O23310|O23310_ARATH-16-117         ---NASTREQDRFLPIANVSRIMKKALP----A-NAKISKDAKETVQECV
Q9SIT9|Q9SIT9_ARATH-41-132         -------------LPIANVGRIMKKVLP----G-NGKISKDAKETVQECV
Q84NF1|Q84NF1_EEEEE-39-128         -------------LPIANISRIMKKAVP----A-NGKIAKDAKETLQECV
Q8S1T8|Q8S1T8_EEEEE-25-114         -------------LPIANISRIMKKAVP----A-NGKIAKDAKETLQECV
Q84NE9|Q84NE9_EEEEE-27-123         -------------LPIANIGRIMRRAVP----E-NGKIAKDSKESVQECV
Q8VYK4|Q8VYK4_ARATH-35-121         -------------LPIANISRIMKRGLP----A-NGKIAKDAKEIVQECV
Q9ZQC3|Q9ZQC3_ARATH-35-126         -------------LPIANISRIMKRGLP----A-NGKIAKDAKEIVQECV
Q9LFI3|Q9LFI3_ARATH-34-120         -------------LPIANISRIMKRGLP----L-NGKIAKDAKETMQECV
Q9FGJ3|Q9FGJ3_ARATH-32-116         -------------LPIANVSRIMKKALP----A-NAKISKDAKETMQECV
Q9SLG0|Q9SLG0_ARATH-26-110         -------------LPIANISRIMKKALP----P-NGKIGKDAKDTVQECV
O76256|O76256_SCHMA-29-113         -------------LPIANVAKIMKRAVP----G-NGKIAKDAKECVQECV
P40914|HAP3_KLULA-27-124           -------------LPINNVARLMKNTLP----A-TTKVSKDAKECMQECV
P13434|HAP3_YEAST-42-129           -------------LPINNVARLMKNTLP----P-SAKVSKDAKECMQECV
O04027|O04027_ARATH-3-111          --------DEDRLLPIANVGRLMKQILP----S-NAKISKEAKQTVQECA
Q942Y5|Q942Y5_ORYSA-38-137         ------------LLPIANVGRIMKQILP----P-NAKISKEAKETMQECV
O82248|O82248_ARATH-55-139         ------------LLPIANVGRIMKNILP----A-NAKVSKEAKETMQECV
Q942Y6|Q942Y6_ORYSA-38-124         -----------NLLPIANVGRIMKDGLP----P-QAKISKRAKETIQECA
O81130|O81130_ARATH-34-118         -------------MPIANVIRIMRKTLP----S-HAKISDDAKETIQECV
Q9SFD8|Q9SFD8_ARATH-34-118         -------------MPIANVIRIMRKTLP----S-HAKISDDAKETIQECV
Q84N51|Q84N51_EEEEE-36-126         ------------LMPIANVIRIMRRVLP----A-HAKISDDAKETIQECV
Q94EJ7|Q94EJ7_MAIZE-41-126         ------------LMPIANVIRIMRRVLP----A-HAKISDDAKETIQECV
Q8LJQ5|Q8LJQ5_PHACN-59-152         -------------MPIANVIRIMRKILP----P-HAKISGDAKETIQECV
Q84W66|Q84W66_ARATH-34-118         -------------MPIANVIRIMRRILP----A-HARISDDSKETIQECV
Q8GV55|Q8GV55_ARATH-63-147         -------------MPIANVIRIMRRILP----A-HAKISDDSKETIQECV
Q9FGJ0|Q9FGJ0_ARATH-34-118         -------------MPIANVIRIMRRILP----A-HAKISDDSKETIQECV
Q8IHQ2|Q8IHQ2_PLAF7-1129-1218      --------DSETLLPIANISRIMKRILP----G-SAKVAKESKDIIRECV
Q8WSK5|Q8WSK5_PLAFA-1129-1218      --------DSETLLPIANISRIMKRILP----G-SAKVAKESKDIIRECV
Q8ST61|Q8ST61_DROME-43-127         -------------LPICNIIKIMKVPVP----Q-NGKIAKDARECIQECV
O17286|O17286_CAEEL-60-170         -------LDQERFLPIANVVRIMKTQMD----P-QAKLAKDAKECAQECV
Q8SR74|Q8SR74_ENCCU-15-99          -------------LPIANISKIMKKPIP----K-EAKVAKDAKEIMQKSA
Q94IM0|Q94IM0_ORYSA-34-118         -------------LPMANLVRLMKKVLP----G-KAKIGGAAKGLTHDCA
Q9BI15|Q9BI15_ENTDI-29-132         -------------LPVANTIRVMRKSVSMPNGS-AVRISKDAQEYMTELA
P49592|DR1_ARATH-16-111            -------------LPKATMTKIIKEMLP----P-DVRVARDAQDLLIECC
Q944I5|Q944I5_ARATH-16-122         -------------LPKATMTKIIKEMLP----A-DVRVARDAQDLLIECC
Q9LEY8|Q9LEY8_ARATH-16-121         -------------LPKATMTKIIKEMLP----A-DVRVARDAQDLLIECC
Q8W0W5|Q8W0W5_SOYBN-16-117         -------------LPKATMTKIIKEMLP----P-DVRVARDAQDLLIECC
Q8W0W9|Q8W0W9_ORYSA-16-119         -------------LPKSTMFKIIKEMLP----P-DVRVARDAQDLLVECC
O14348|O14348_SCHPO-12-111         -------------LPKATVQKMVSDILP----V-DLTFTKEARDLLIECC
Q8W0W8|Q8W0W8_WHEAT-16-89          -------------LPKSTMTKIIKEMLP----P-DVRVARDTQDLLVECC
O13068|O13068_EEEEE-3-105          ---SSSGTDDDLTIPRAAINKMIKETLP------SVRVANDARELVVNCC
Q91WV0|Q91WV0_MOUSE-3-105          ---SSSGNDDDLTIPRAAINKMIKETLP------NVRVANDARELVVNCC
Q01658|TBAP_HUMAN-3-105            ---SSSGNDDDLTIPRAAINKMIKETLP------NVRVANDARELVVNCC
Q9NKA2|Q9NKA2_DROME-20-107         -------------LPRASINKIIKELVP------TVRVANESRELILNCC
Q9VJQ5|Q9VJQ5_DROME-20-107         -------------LPRASINKIIKELVP------TVRVANESRELILNCC
O45550|O45550_CAEEL-22-126         -------------LPQKGINQIIKEVVP------EMRIANESRDMINACC
Q04176|Q04176_YEAST-10-112         ----------------ATVQKMISEILD----Q-DLMFTKDAREIIINSG
Q92317|Q92317_YEAST-4-115          -------DSDNVSLPKATVQKMISEILD----Q-DLMFTKDAREIIINSG
Q9NRF9|DPE3_HUMAN-10-112           -------------LPNAVITRIIKEALP----D-GVNISKEARSAISRAA
Q8NCE5|Q8NCE5_HUMAN-10-112         -------------LPNAVITRIIKEALP----D-GVNISKEARSAISRAA
Q8N758|Q8N758_HUMAN-10-112         -------------LPNAVITRIIKEALP----D-GVNISKEARSAISRAA
Q9JKP7|DPE3_MOUSE-10-96            -------------LPNAVITRIIKEALP----D-GVNISKEARSAISRAA
Q86F18|Q86F18_SCHJA-10-111         -------------LPNAVLLRIIRESLP----E-RTLVSREARSAISKSA
Q9V444|Q9V444_DROME-10-107         -------------LPNAVIGRLIKEALP----E-SASVSKEARAAIARAA
Q86J49|Q86J49_DICDI-7-88           -------------LPGAIVNRIIKASLP----E-GVLCAKESRLAIAKAA
P87174|P87174_SCHPO-17-99          -------------LPRSIIMRLVKGVLP----E-KSLVQKEALKAMINSA
Q8SQX5|Q8SQX5_ENCCU-1-85           --MNMEKNDDENTLPKATVDKMVSSMLP----K-NSVVPKESKEIFQNAC
Q9ZQH2|Q9ZQH2_ARATH-11-98          -------------LPLAIVRRVVKKKLSECSPDYDVSIHKEALLAFSESA
Q22798|Q22798_CAEEL-1-82           MSSNDVDQNDDRIAQMMMPAAIVTRLMK----EDNISASKDARDVIARAA
CONSENSUS                          MSSNDSDNDDDRLLPIANVSRIMKKALP----E-NAKIAKDAKECIQECV
                                                        ::   :              :        

P25208|CBFA_HUMAN-59-143           SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKLY
P22569|CBFA_MOUSE-59-143           SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKLY
Q63091|Q63091_RAT-21-105           SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKLY
Q8C590|Q8C590_MOUSE-59-143         SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKLY
Q9D056|Q9D056_MOUSE-21-105         SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKLY
O73744|O73744_XENLA-58-142         SEFISFITSEASE--RCHQEKRKTINGEDILFAMSRLGFD-SYVEPLKLY
P25210|CBFA_PETMA-60-155           SEFISFITSEASE--RCHQEKRKTINGEDILFAMSTLGFD-SYVEPLKQY
Q8WQQ1|Q8WQQ1_STRPU-60-157         SEFISFITSEASE--RCHQEKRKTINGEDILYAMSNLGFD-NYVDPLKSY
O59848|O59848_ASPOR-48-135         SEFISFITSEASE--KCQQEKRKTVNGEDILFAMTSLGFE-NYAEALKIY
Q00735|Q00735_EMENI-48-135         SEFISFITSEASE--KCQQEKRKTVNGEDILFAMTSLGFE-NYAEALKIY
Q86ZV5|Q86ZV5_ASPNG-49-136         SEFISFITSEASE--KCQQEKRKTVNGEDILFAMTSLGFE-NYAEALKIY
Q96WP0|Q96WP0_TRIRE-51-140         SEFISFITSEASE--KCQQEKRKTVNGEDILFAMTSLGFE-NYAEALKVY
P36611|PHP3_SCHPO-12-101           SEFISFVTGEASE--QCTQEKRKTITGEDVLLALNTLGFE-NYAEVLKIS
P25209|CBFA_MAIZE-36-125           SEFISFITSEASD--KCQREKRKTINGDDLLWAMATLGFE-DYIEPLKVY
O23310|O23310_ARATH-16-117         SEFISFITGEASD--KCQREKRKTINGDDLLWAMTTLGFE-DYVEPLKVY
Q9SIT9|Q9SIT9_ARATH-41-132         SEFISFVTGEASD--KCQREKRKTINGDDIIWAITTLGFE-DYVAPLKVY
Q84NF1|Q84NF1_EEEEE-39-128         SEFISFVTSEASD--KCQKEKRKTINGEDLLFAMGTLGFE-EYVDPLKIY
Q8S1T8|Q8S1T8_EEEEE-25-114         SEFISFVTSEASD--KCQKEKRKTINGEDLLFAMGTLGFE-EYVDPLKIY
Q84NE9|Q84NE9_EEEEE-27-123         SEFISFITSEASD--KCLKEKRKTINGDDLIWSMGTLGFE-DYVEPLKLY
Q8VYK4|Q8VYK4_ARATH-35-121         SEFISFVTSEASD--KCQREKRKTINGDDLLWAMATLGFE-DYMEPLKVY
Q9ZQC3|Q9ZQC3_ARATH-35-126         SEFISFVTSEASD--KCQREKRKTINGDDLLWAMATLGFE-DYMEPLKVY
Q9LFI3|Q9LFI3_ARATH-34-120         SEFISFVTSEASD--KCQREKRKTINGDDLLWAMATLGFE-DYIDPLKVY
Q9FGJ3|Q9FGJ3_ARATH-32-116         SEFISFVTGEASD--KCQKEKRKTINGDDLLWAMTTLGFE-DYVEPLKVY
Q9SLG0|Q9SLG0_ARATH-26-110         SEFISFITSEASD--KCQKEKRKTVNGDDLLWAMATLGFE-DYLEPLKIY
O76256|O76256_SCHMA-29-113         SEFISFITSELPD--KCQTEKRKTINGEDILCAMNTLGFD-NYIEPLRAF
P40914|HAP3_KLULA-27-124           SEFISFVTSEACD--RCTSGKRKTINGEDILLSLHALGFE-NYAEVLKIY
P13434|HAP3_YEAST-42-129           SELISFVTSEASD--RCAADKRKTINGEDILISLHALGFE-NYAEVLKIY
O04027|O04027_ARATH-3-111          TEFISFVTCEASE--KCHRENRKTVNGDDIWWALSTLGLD-NYADAVGRH
Q942Y5|Q942Y5_ORYSA-38-137         SEFISFVTGEASD--KCHKEKRKTVNGDDVCWAFGALGFD-DYVDPMRRY
O82248|O82248_ARATH-55-139         SEFISFVTGEASD--KCHKEKRKTVNGDDICWAMANLGFD-DYAAQLKKY
Q942Y6|Q942Y6_ORYSA-38-124         TEFISFVTGEASE--RCRRERRKTVNGDDVCHAMRSLGLD-HYADAMHRY
O81130|O81130_ARATH-34-118         SEYISFVTGEANE--RCQREQRKTITAEDILWAMSKLGFD-NYVDPLTVF
Q9SFD8|Q9SFD8_ARATH-34-118         SEYISFVTGEANE--RCQREQRKTITAEDILWAMSKLGFD-NYVDPLTVF
Q84N51|Q84N51_EEEEE-36-126         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSRLGFD-DYVEPLGVY
Q94EJ7|Q94EJ7_MAIZE-41-126         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSRLGFD-DYVEPLGAY
Q8LJQ5|Q8LJQ5_PHACN-59-152         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSKLGFD-DYMEPLTMY
Q84W66|Q84W66_ARATH-34-118         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSKLGFD-DYIEPLTLY
Q8GV55|Q8GV55_ARATH-63-147         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSKLGFD-DYIEPLTLY
Q9FGJ0|Q9FGJ0_ARATH-34-118         SEYISFITGEANE--RCQREQRKTITAEDVLWAMSKLGFD-DYIEPLTLY
Q8IHQ2|Q8IHQ2_PLAF7-1129-1218      TEFIQFLTSEASD--RCTREKRKTINGEDILYSMEKLGFN-DYIEPLTEY
Q8WSK5|Q8WSK5_PLAFA-1129-1218      TEFIQFLTSEASD--RCTREKRKTINGEDILYSMEKLGFN-DYIEPLTEY
Q8ST61|Q8ST61_DROME-43-127         SEFISFISSEAIE--RSVAENRKTVNGDDLLVAFSNLGFD-NYVEPLSIY
O17286|O17286_CAEEL-60-170         SEFISFIASEAAE--ICNITKRKTITADDLLTAMEATGFD-NYAEPMRIF
Q8SR74|Q8SR74_ENCCU-15-99          GEFIAIITCRAKE--ICESEARKTVTGEDLIRAMDELDMP-YYAELARKY
Q94IM0|Q94IM0_ORYSA-34-118         VEFVGFVGDEASE--KAKAEHRRTVAPEDYLGSFGDLGFD-RYVDPMDAY
Q9BI15|Q9BI15_ENTDI-29-132         TEFLSFIASEAADVPKGSVKSKHTLTGADVIDALDRLGFE-DYCPSLQKH
P49592|DR1_ARATH-16-111            VEFINLVSSESND--VCNKEDKRTIAPEHVLKALQVLGFG-EYIEEVYAA
Q944I5|Q944I5_ARATH-16-122         VEFINLISSESNE--VCNKEDKRTIAPEHVLKALQVLGFG-EYVEEVYAA
Q9LEY8|Q9LEY8_ARATH-16-121         VEFINLISSESNE--VCNKEDKRTIAPEHVLKALQVLGFG-EYVEEVYAA
Q8W0W5|Q8W0W5_SOYBN-16-117         VEFINLVSSESNE--VCNKEERRTIAPEHVLKALGVLGFG-EYIEEVYAA
Q8W0W9|Q8W0W9_ORYSA-16-119         VEFINLLSSESNE--VCSREDKKTIAPEHVLRALQDLGFR-EYIEEVQAA
O14348|O14348_SCHPO-12-111         VEFIHLVSSEANE--ICEKEAKKTIAAEHIIKALENLEFK-EYIAEALEV
Q8W0W8|Q8W0W8_WHEAT-16-89          VEFINLLSSESND--VCSRDDKKTIAPEHVIRALQDLGFK-EYVE-----
O13068|O13068_EEEEE-3-105          TEFIHLISSEANE--ICNKSEKKTISPEHVIQALESLGFG-SYISEVKEV
Q91WV0|Q91WV0_MOUSE-3-105          TEFIHLISSEANE--ICNKSEKKTISPEHVIQALESLGFG-SYISEVKEV
Q01658|TBAP_HUMAN-3-105            TEFIHLISSEANE--ICNKSEKKTISPEHVIQALESLGFG-SYISEVKEV
Q9NKA2|Q9NKA2_DROME-20-107         SEFIHLISSEANE--VCNMRNKKTINAEHVLEALERLGFH-DYKQEAEAV
Q9VJQ5|Q9VJQ5_DROME-20-107         SEFIHLISSEANE--VCNMRNKKTINAEHVLEALERLGFH-DYKQEAEAV
O45550|O45550_CAEEL-22-126         VEFVKHIAREAQR--IASQDQRKTIYHEHVQKALQNLGFTPDYLEAADSV
Q04176|Q04176_YEAST-10-112         IEFIMILSSMASE--MADNEAKKTIAPEHVIKALEELEYN-EFIPFLEEI
Q92317|Q92317_YEAST-4-115          IEFIMILSSMASE--MADNEAKKTIAPEHVIKALEELEYN-EFIPFLEEI
Q9NRF9|DPE3_HUMAN-10-112           SVFVLYATSCANN--FAMKGKRKTLNASDVLSAMEEMEFQ-RFVTPLKEA
Q8NCE5|Q8NCE5_HUMAN-10-112         SVFVLYATSCANN--FAMNGKRKTLNASDVLSAMEEMEFQ-RFVTPLKEA
Q8N758|Q8N758_HUMAN-10-112         SVFVLYATSCANN--FAMKGKRKTLNASDVLSAMEEMEFQ-RFVIPLKEA
Q9JKP7|DPE3_MOUSE-10-96            SVFVLYATSCANN--FAMKGKRKTLNASDVLSAMEEMEFQ-RFITPLKEA
Q86F18|Q86F18_SCHJA-10-111         SSFILYVTSLASV--HSEKAKRKTLTGNDILAALKEMEFD-HFIPALKEF
Q9V444|Q9V444_DROME-10-107         SVFAIFVTSSSTA--LAHKQNHKTITAKDILQTLTELDFE-SFVPSLTQD
Q86J49|Q86J49_DICDI-7-88           KVWIHYLTAASID--FSSHSGRSTISPKDVFQAIEEIDFE-NFKPQLEEY
P87174|P87174_SCHPO-17-99          TLFVSFLTSASGE--IATNNNRKILMPQDVLNALDEIEYP-EFSKTLKKH
Q8SQX5|Q8SQX5_ENCCU-1-85           IYFLNMLTLEANK--ACEEEKKKTISYEHVYKALKNLGFE-SYVE-----
Q9ZQH2|Q9ZQH2_ARATH-11-98          RIFIHYLSATAND--FCKDARRQTMKADDVFKALEEMDFS-EFLEPLKSS
Q22798|Q22798_CAEEL-1-82           AVFLINLSDVSAQ--SARDQKHKTISGDDVVKGLRELE------------
CONSENSUS                          SEFISFITSEASE--KCQKEKRKTINGEDILWAMEELGFD-DYVEPLKVY
                                                        :  :   .    :                

P25208|CBFA_HUMAN-59-143           LQKFRE----------------------
P22569|CBFA_MOUSE-59-143           LQKFRE----------------------
Q63091|Q63091_RAT-21-105           LQKFRE----------------------
Q8C590|Q8C590_MOUSE-59-143         LQKFRE----------------------
Q9D056|Q9D056_MOUSE-21-105         LQKFRE----------------------
O73744|O73744_XENLA-58-142         LQKFRE----------------------
P25210|CBFA_PETMA-60-155           LQKYRESMKGEKGINAT-----------
Q8WQQ1|Q8WQQ1_STRPU-60-157         LQKYRESMKGDKVIXQARQ---------
O59848|O59848_ASPOR-48-135         LSKYRETQS-------------------
Q00735|Q00735_EMENI-48-135         LSKYRETQS-------------------
Q86ZV5|Q86ZV5_ASPNG-49-136         LSKYRETQS-------------------
Q96WP0|Q96WP0_TRIRE-51-140         LSKYREQQNQS-----------------
P36611|PHP3_SCHPO-12-101           LTKYREQQARS-----------------
P25209|CBFA_MAIZE-36-125           LQKYREMEGDS-----------------
O23310|O23310_ARATH-16-117         LQKYREVEGEKTT---------------
Q9SIT9|Q9SIT9_ARATH-41-132         LCKYRDTEGEKVN---------------
Q84NF1|Q84NF1_EEEEE-39-128         LHKYREMEGDS-----------------
Q8S1T8|Q8S1T8_EEEEE-25-114         LHKYREMEGDS-----------------
Q84NE9|Q84NE9_EEEEE-27-123         LRLYRETEGDTKGSRASE----------
Q8VYK4|Q8VYK4_ARATH-35-121         LMRYREME--------------------
Q9ZQC3|Q9ZQC3_ARATH-35-126         LMRYREGDTKGSA---------------
Q9LFI3|Q9LFI3_ARATH-34-120         LMRYREME--------------------
Q9FGJ3|Q9FGJ3_ARATH-32-116         LQRFRE----------------------
Q9SLG0|Q9SLG0_ARATH-26-110         LARYRE----------------------
O76256|O76256_SCHMA-29-113         LVKFRE----------------------
P40914|HAP3_KLULA-27-124           LAKYRQQQAIKNQMMYPKE---------
P13434|HAP3_YEAST-42-129           LAKYRQQQA-------------------
O04027|O04027_ARATH-3-111          LHKYREAERERTEHNKGSNDSGNEK---
Q942Y5|Q942Y5_ORYSA-38-137         LNKYRELEGDRAAAAATSRS--------
O82248|O82248_ARATH-55-139         LHRYR-----------------------
Q942Y6|Q942Y6_ORYSA-38-124         LQRYRE----------------------
O81130|O81130_ARATH-34-118         INRYRE----------------------
Q9SFD8|Q9SFD8_ARATH-34-118         INRYRE----------------------
Q84N51|Q84N51_EEEEE-36-126         LHRYREFEGES-----------------
Q94EJ7|Q94EJ7_MAIZE-41-126         LHRYRE----------------------
Q8LJQ5|Q8LJQ5_PHACN-59-152         LHRYRELEGDRTSMR-------------
Q84W66|Q84W66_ARATH-34-118         LHRYRE----------------------
Q8GV55|Q8GV55_ARATH-63-147         LHRYRE----------------------
Q9FGJ0|Q9FGJ0_ARATH-34-118         LHRYRE----------------------
Q8IHQ2|Q8IHQ2_PLAF7-1129-1218      LNKWKQ----------------------
Q8WSK5|Q8WSK5_PLAFA-1129-1218      LNKWKQ----------------------
Q8ST61|Q8ST61_DROME-43-127         LQKYRE----------------------
O17286|O17286_CAEEL-60-170         LQKYRQAHKITGPIHRTHPDYVRPPQ--
Q8SR74|Q8SR74_ENCCU-15-99          YIQYRE----------------------
Q94IM0|Q94IM0_ORYSA-34-118         IHGYRE----------------------
Q9BI15|Q9BI15_ENTDI-29-132         LNHFRQVNAQDDGYEPRKE---------
P49592|DR1_ARATH-16-111            YEQHKYETMQDTQRSVK-----------
Q944I5|Q944I5_ARATH-16-122         YEQHKYETMQDSQRSVKMNSGAEMTEEE
Q9LEY8|Q9LEY8_ARATH-16-121         YEQHKYETM-DSQRSVKMNSGAEMTEEE
Q8W0W5|Q8W0W5_SOYBN-16-117         YEQHKLETMQDSLKGAKWSNRAE-----
Q8W0W9|Q8W0W9_ORYSA-16-119         YEHHKHDTL-DSPKASKF-TGVEMTEE-
O14348|O14348_SCHPO-12-111         AAEHKEQQKNREKKSSKFEQS-------
Q8W0W8|Q8W0W8_WHEAT-16-89          ----------------------------
O13068|O13068_EEEEE-3-105          LQECKTVALKRRKAS-------------
Q91WV0|Q91WV0_MOUSE-3-105          LQECKTVALKRRKAS-------------
Q01658|TBAP_HUMAN-3-105            LQECKTVALKRRKAS-------------
Q9NKA2|Q9NKA2_DROME-20-107         LHDCKEVAAK------------------
Q9VJQ5|Q9VJQ5_DROME-20-107         LHDCKEVAAK------------------
O45550|O45550_CAEEL-22-126         LDACKVEAEKKLRRKNSRLEKCGIPE--
Q04176|Q04176_YEAST-10-112         LLNFKGSQKVKETRDSKF-KKSGLSEEE
Q92317|Q92317_YEAST-4-115          LLNFKGSQKVKETRDSKF-KKSGLSEEE
Q9NRF9|DPE3_HUMAN-10-112           LEAYRREQKGKKEASEQKKKDKDK----
Q8NCE5|Q8NCE5_HUMAN-10-112         LEAYRREQKGKKEASEQKKKDKDK----
Q8N758|Q8N758_HUMAN-10-112         LEAYRREQKGKKEASEQKKKDKDK----
Q9JKP7|DPE3_MOUSE-10-96            LEAYRRDE--------------------
Q86F18|Q86F18_SCHJA-10-111         LDKYREQVVAKKTTKRMQNESEE-----
Q9V444|Q9V444_DROME-10-107         LEVYRKVVKEKKESKASKK---------
Q86J49|Q86J49_DICDI-7-88           LAA-------------------------
P87174|P87174_SCHPO-17-99          LEAY------------------------
Q8SQX5|Q8SQX5_ENCCU-1-85           ----------------------------
Q9ZQH2|Q9ZQH2_ARATH-11-98          LEDF------------------------
Q22798|Q22798_CAEEL-1-82           ----------------------------
CONSENSUS                          LQKYREQQKEKKERSSKKEESAEMPEEE