Plant Transcription factor database - Universität Potsdam
version: 3.0

NF-YC HMM

The NF-YC domain is characteristic of the CCAAT_HAP5 transcription factor family. The alignment for the ProDom family PD003659 was used as seed alignment.

CLUSTAL W (1.82) multiple sequence alignment


Q13952|CBFC_HUMAN-44-117         ------------PLARIKKIMKLDEDVK---MISAEAPVLFAKAAQIFIT
Q62725|CBFC_RAT-44-117           ------------PLARIKKIMKLDEDVK---MISAEAPVLFAKAAQIFIT
O73745|O73745_XENLA-42-115       ------------PLARIKKIMKLDEDVK---MISAEAPVLFAKAAQIFIT
Q7ZVY3|Q7ZVY3_BRARE-42-115       ------------PLARIKKIMKLDEDVK---MISAEAPVLFAKAAQIFIT
P70353|CBFC_MOUSE-44-117         ------------PLARIKKIMKLDEDVK---MISAEAPVLFAKGAQIFIT
O04033|O04033_ARATH-59-132       ------------PLARIKKIMKADEDVR---MISAEAPVVFARACEMFIL
Q9SNZ0|Q9SNZ0_ARATH-77-155       -------KKHSLPLARIKKIMKADEDVR---MISAEAPVVFARACEMFIL
Q8L4B2|Q8L4B2_ARATH-82-155       ------------PLARIKKIMKADEDVR---MISAEAPVVFARACEMFIL
Q9ZVL3|Q9ZVL3_ARATH-72-145       ------------PLARIKKIMKADEDVR---MISAEAPVVFARACEMFIL
O23636|O23636_ARATH-16-89        ------------PLARIKKIMKADEDVR---MISAEAPVIFAKACEMFIL
Q9SGU4|Q9SGU4_ARATH-16-89        ------------PLARIKKIMKADEDVR---MISAEAPVIFAKACEMFIL
Q8VY66|Q8VY66_ARATH-78-151       ------------PLARIKKIMKADEDVR---MISAEAPVIFAKACEMFIL
Q9FMV5|Q9FMV5_ARATH-80-163       ------------PLARIKKIMKADEDVR---MISAEAPILFAKACELFIL
Q9SMP0|Q9SMP0_ARATH-67-140       ------------PLARIKKIMKADEDVR---MISAEAPILFAKACELFIL
Q8LCG7|Q8LCG7_ARATH-78-150       ------------PLARIKKIMKADEDVR---MISAEAPVIFAKACEMFIL
Q9XE33|Q9XE33_ORYSA-92-165       ------------PLARIKKIMKADEDVR---MIAAEAPVVFARACEMFIL
Q02516|HAP5_YEAST-161-234        ------------PFARIRKVMKTDEDVK---MISAEAPIIFAKACEIFIT
O13381|O13381_NEUCR-84-167       -------KLHQLPLARIKKVMKADPEVK---MISAEAPILFAKGCDIFIT
Q96WN9|Q96WN9_TRIRE-84-167       -------KIHQLPLARIKKVMKADPEVK---MISAEAPILFAKGCDIFIT
O59849|O59849_ASPOR-83-166       -------KIHQLPLARIKKVMKADPEVK---MISAEAPILFAKGCDIFIT
P87092|P87092_EMENI-83-166       -------KIHQLPLARIKKVMKADPEVK---MISAEAPILFAKGCDVFIT
P79007|PHP5_SCHPO-98-185         EHDDQAVKTLHLPLARIKKVMKTDDDVK-NKMISAEAPFLFAKGSEIFIA
Q9W3V9|Q9W3V9_DROME-155-228      ------------PLARIKKIMKLDENAK---MIAGEAPLLFAKACEYFIQ
Q9FGP7|Q9FGP7_ARATH-56-129       ------------PLARIKKIMKADPDVH---MVSAEAPIIFAKACEMFIV
Q8SSZ4|Q8SSZ4_DICDI-272-345      ------------PLARIKKIMKSDKDVN---KISSEAPILFAKACEILIL
Q8SRY9|Q8SRY9_ENCCU-35-115       -------KDLNLPLARIKRLMKIEEGVR---MVASEVPVLFSMITEKFIE
Q8IL74|Q8IL74_PLAF7-36-118       ------------PISRIKKIMKEDDEIKSNQMVSADTPVLLAKACELFIM
Q9FGP6|Q9FGP6_ARATH-37-110       -----------FPISRIKRIMKFDPDVS---MIAAEAPNLLSKACEMFVM
Q9FF42|Q9FF42_ARATH-66-145       ---------THLPLSRVRKILKSDPEVK---KISCDVPALFSKACEYFIL
O17072|O17072_CAEEL-111-185      ------------PMARVKKIMRIDDDVR-NFMIASDAPIFMAQAAEFFIE
Q9FGP8|Q9FGP8_ARATH-64-144       -----------FPLTRIKKIMKSNPEVN---MVTAEAPVLISKACEMLIL
Q8LMX6|Q8LMX6_EEEEE-53-127       -----------LPISRVKNIIHAKEGGM---MLSADTPAFVTKLCELFVQ
Q8W099|Q8W099_ORYSA-45-118       ------------PMARLKKIVSSQKGNM---MMTFDMPAFLSKMCELFVQ
Q93VF0|Q93VF0_ORYSA-45-118       ------------PMARLKKIASSQKGNM---MMSFDMPAFLSKMCELFVQ
Q9NR33|DPE4_HUMAN-38-112         --------LSRLPLARVKALVKADPDVT---LAGQEAIFILARAAELFVE
Q9CQ36|DPE4_MOUSE-37-113         ------VRLSRLPLARVKALVKADPDVT---LAGQEAIFILARAAELFVE
Q8MSF2|Q8MSF2_DROME-52-127       -------KMTQLPLARIRNIMKLDPDLH---MANNEAVFIVAKAVELFIA
Q9W256|Q9W256_DROME-74-149       -------KMTQLPLARIRNIMKLDPDLH---MANNEAVFIVAKAVELFIA
Q9NAC5|Q9NAC5_CAEEL-34-109       ---------SQLPLGRVKKVVRMNPDVE---MLNNEALQLMAKAAELFIK
Q86HI1|Q86HI1_DICDI-80-151       ------------PVARIKRIMRCDKDVK---IISSDAVMLVAKSTEMFLD
P40096|NCB1_YEAST-51-125         ---------THFPPAKVKKIMQTDEDIG---KVSQATPVIAGRSLEFFIA
Q13448|Q13448_HUMAN-4-74         ---------------RIKKIMQTDEEIG---KVAAAVPVIISRALELFLE
Q14919|Q14919_HUMAN-3-86         --SKKKKYNARFPPARIKKIMQTDEEIG---KVAAAVPVIISRALELFLE
Q9D6N5|Q9D6N5_MOUSE-3-86         --SKKKKYNARFPPARIKKIMQTDEEIG---KVAAAVPVIISRALELFLE
Q7ZVI1|Q7ZVI1_BRARE-3-86         --SKKKKYNARFPPARIKKIMQTDEEIG---KVAAAVPVIISRALELFLE
Q9GSP1|Q9GSP1_DROME-3-86         --SKKKKYNARFPAGRIKKIMQSDEEIG---KVAQAVPVIISRTLELFVE
Q9W2E3|Q9W2E3_DROME-3-86         --SKKKKYNARFPAGRIKKIMQSDEEIG---KVAQAVPVIISRTLELFVE
Q8W0W6|Q8W0W6_MAIZE-2-80         ----RKKLGTRFPAARIKKIMQADEDVG---KIALAVPVLVSRSLELFLQ
Q8W0W7|Q8W0W7_ORYSA-2-80         ----RKKLGTRFPAARIKKIMQADEDVG---KIALAVPVLVSRALELFLQ
Q9LHG0|Q9LHG0_ARATH-2-83         ----RKKLDTRFPAARIKKIMQADEDVG---KIALAVPVLVSKSLELFLQ
Q9C7A7|Q9C7A7_ARATH-16-87        --------------ARIKKIMQADEDVG---KIALAVPVLVSKSLELFLQ
Q10315|YD63_SCHPO-22-98          ---------SRFPVARIKKIMQADQDVG---KVAQVTPVIMSKALELFMQ
Q8MLV5|Q8MLV5_DROME-1-66         --------------------MQSDEEIG---KVAQAVPVIISRTLELFVE
Q8SQT6|Q8SQT6_ENCCU-10-93        -------KLTRFPISRLKRIMQLNEDIG---KIGASVPVVASKAIEMFLT
Q20237|Q20237_CAEEL-68-140       -------------PTRIKKVMQSDEDIG---RMVQSVPVSIGRAMEHFAE
Q86G95|Q86G95_CAEEL-42-114       -------------PTRIKKVMQSDEDIG---RMVQSVPVSIGRAMEHFAE
Q9FHS0|Q9FHS0_ARATH-12-86        -----------FPIGRVKKIMKLDKDIN---KINSEALHVITYSTELFLH
Q9LGS9|Q9LGS9_ORYSA-167-241      -----------LPLGRVKRIIRVDRDIK---KVTNEAALLIAAATELFVG
Q9NRG0|CHR1_HUMAN-19-97          -----------LPLSRIRVIMKSSPEVS---SINQEALVLTAKATELFVQ
Q9JKP8|CHR1_MOUSE-19-97          -----------LPLSRIRVIMKSSPEVS---SINQEALVLTAKATELFVQ
Q9V452|Q9V452_DROME-20-101       -----------LPLSRVRTIMKSSMDTG---LITNEVLFLMTKCTELFVR
Q9LN09|Q9LN09_ARATH-104-188      -----EDAKIKFPMNRIRRIMRSDNSAP---QIMQDAVFLVNKATEMFIE
P27344|DPB3_YEAST-6-95           -----KEKAPVFPISKVKKIAKCDPEYV---ITSNVAISATAFAAELFVQ
Q851X6|Q851X6_EEEEE-206-257      -----------FPMARVRQIMRAEDATI---RPSNEAVFLINKATEIFLK
CONSENSUS                        EHSKKKKKMTRFPLARIKKIMKADEDVK---MISAEAPVLIAKACELFIQ
                                                        .                     : :  

Q13952|CBFC_HUMAN-44-117         ELTLRAWIHTEDNKRRTLQRND------IAMAITKFDQFDFLIDI-----
Q62725|CBFC_RAT-44-117           ELTLRAWIHTEDNKRRTLQRND------IAMAITKFDQFDFLIDI-----
O73745|O73745_XENLA-42-115       ELTLRAWIHTEDNKRRTLQRND------IAMAITKFDQFDFLIDI-----
Q7ZVY3|Q7ZVY3_BRARE-42-115       ELTLRAWIHTEDNKRRTLQRND------IAMAITKFDQFDFLIDI-----
P70353|CBFC_MOUSE-44-117         ELTLRAWIRTEDNKRRPLQRND------IAMAITKFDQFDFLIDI-----
O04033|O04033_ARATH-59-132       ELTLRSWNHTEENKRRTLQKND------IAAAVTRTDIFDFLVDI-----
Q9SNZ0|Q9SNZ0_ARATH-77-155       ELTLRSWNHTEENKRRTLQKND------IAAAVTRTDIFDFLVDI-----
Q8L4B2|Q8L4B2_ARATH-82-155       ELTLRSWNHTEENKRRTLQKND------IAAAVTRTDIFDFLVDI-----
Q9ZVL3|Q9ZVL3_ARATH-72-145       ELTLRSWNHTEENKRRTLQKND------IAAAVTRTDIFDFLVDI-----
O23636|O23636_ARATH-16-89        ELTLRAWIHTEENKRRTLQKND------IAAAISRTDVFDFLVDI-----
Q9SGU4|Q9SGU4_ARATH-16-89        ELTLRAWIHTEENKRRTLQKND------IAAAISRTDVFDFLVDI-----
Q8VY66|Q8VY66_ARATH-78-151       ELTLRAWIHTEENKRRTLQKND------IAAAISRTDVFDFLVDI-----
Q9FMV5|Q9FMV5_ARATH-80-163       ELTIRSWLHAEENKRRTLQKND------IAAAITRTDIFDFLVDIVPREE
Q9SMP0|Q9SMP0_ARATH-67-140       ELTIRSWLHAEENKRRTLQKND------IAAAITRTDIFDFLVDI-----
Q8LCG7|Q8LCG7_ARATH-78-150       ELTLRAWIHTEENKRRTLQKND------IAAAISRTDV-DFLVDI-----
Q9XE33|Q9XE33_ORYSA-92-165       ELTHRGWAHAEENKRRTLQKSD------IAAAIARTEVFDFLVDI-----
Q02516|HAP5_YEAST-161-234        ELTMRAWCVAERNKRRTLQKAD------IAEALQKSDMFDFLIDV-----
O13381|O13381_NEUCR-84-167       ELTMRAWIHAEENKRRTLQRSD------IASALSKSDMFDFLIDIVPREE
Q96WN9|Q96WN9_TRIRE-84-167       ELTMRAWIHAEENKRRTLQRSD------IASALAKSDMFDFLIDIVPREE
O59849|O59849_ASPOR-83-166       ELTMRAWIHAEDNKRRTLQRSD------IAAALSKSDMFDFLIDIVPREE
P87092|P87092_EMENI-83-166       ELTMRAWIHAEDNKRRTLQRSD------IAAALSKSDMFDFLIDIVPREE
P79007|PHP5_SCHPO-98-185         ELTMRAWLHAKKNQRRTLQRSD------IANAVSKSEMYDFLIDI-----
Q9W3V9|Q9W3V9_DROME-155-228      ELTMHAWVHTEESRRRTLQRSD------IAQAIANYDQFDFLIDI-----
Q9FGP7|Q9FGP7_ARATH-56-129       DLTMRSWLKAEENKRHTLQKSD------ISNAVASSFTYDFLLDV-----
Q8SSZ4|Q8SSZ4_DICDI-272-345      EMTHRSWVHTEMNKRRTLQRTD------IINSLSRCETFDFLIDM-----
Q8SRY9|Q8SRY9_ENCCU-35-115       ELTLRAWINTEENKRRILQKSD------LTAAVKTSEMFDFLVYIVP---
Q8IL74|Q8IL74_PLAF7-36-118       ELTSNAWKYTEEGKRRTLQRQD------VVSAACKKDTFDFLIDLIPLED
Q9FGP6|Q9FGP6_ARATH-37-110       DLTMRSWLHAQESNRLTIRKSD------VDAVVSQTVIFDFLRD------
Q9FF42|Q9FF42_ARATH-66-145       EVTLRAWMHTQSCTRETIRRCD------IFQAVKNSGTYDFLIDRVPF--
O17072|O17072_CAEEL-111-185      EMTAMGWQYVSEARRRILQKAD------IASAVQKSDQFDFLID------
Q9FGP8|Q9FGP8_ARATH-64-144       DLTMRSWLHTVEGGRQTLKRSDTLTRSDISAATTRSFKFTFLGDV-----
Q8LMX6|Q8LMX6_EEEEE-53-127       ELILRAWVCANSHNREIILGTD------IAEAITTTESYHFLANV-----
Q8W099|Q8W099_ORYSA-45-118       ELAVRAWASAQSHNRCIILDTD------IAKAIASTESYDFLVDI-----
Q93VF0|Q93VF0_ORYSA-45-118       ELAVRAWASAQSHNRCIILDTD------IAEAIASTESYDFLVDI-----
Q9NR33|DPE4_HUMAN-38-112         TIAKDAYCCAQQGKRKTLQRRD------LDNAIEAVDEFAFL--------
Q9CQ36|DPE4_MOUSE-37-113         TIAKDAYCCAQQGKRKTLQRRD------LDNAIEAVDEFAFL--------
Q8MSF2|Q8MSF2_DROME-52-127       SLSRESYTYTAQSKKKTIQKRD------VDMAISAVDSLLFL--------
Q9W256|Q9W256_DROME-74-149       SLSRESYTYTAQSKKKTIQKRD------VDMAISAVDSLLFL--------
Q9NAC5|Q9NAC5_CAEEL-34-109       ELSNAANQNAALEKRKTVQTKD------IDKAIKKTWAFAFLED------
Q86HI1|Q86HI1_DICDI-80-151       YLVKEAY--KSSGKKKTLQYKD------LASTIKGVDNLDFLSEI-----
P40096|NCB1_YEAST-51-125         LLVKKSGEMARGQGTKRITAEI------LKKTILNDEKFDFLR-------
Q13448|Q13448_HUMAN-4-74         SLLKKACQVTQSRNAKTMTTSH------LKQCIELEQQFDFLKDL-----
Q14919|Q14919_HUMAN-3-86         SLLKKACQVTQSRNAKTMTTSH------LKQCIELEQQFDFLKDL-----
Q9D6N5|Q9D6N5_MOUSE-3-86         SLLKKACQVTQSRNAKTMTTSH------LKQCIELEQQFDFLKDL-----
Q7ZVI1|Q7ZVI1_BRARE-3-86         SLLTKACDVTQSRNAKTMTTSH------LKQCIELEQQFDFLKDL-----
Q9GSP1|Q9GSP1_DROME-3-86         SLLTKTLRITNARNAKTLSPSH------MRQCIVSEKRFDFLKEL-----
Q9W2E3|Q9W2E3_DROME-3-86         SLLTKTLRITNARNAKTLSPSH------MRQCIVSEKRFDFLKEL-----
Q8W0W6|Q8W0W6_MAIZE-2-80         DLIDRTYEITLQSGAKTLNSFH------LKQCVKRYSSFDFL--------
Q8W0W7|Q8W0W7_ORYSA-2-80         DLIDRTYEITLQSGAKTLNSFH------LKQCVRRYSSFDFL--------
Q9LHG0|Q9LHG0_ARATH-2-83         DLCDRTYEITLERGAKTVSSLH------LKHCVERYNVFDFLREV-----
Q9C7A7|Q9C7A7_ARATH-16-87        DLCDRTYEITLERGAKTVSSLH------LKHCVERYNVFDFLREV-----
Q10315|YD63_SCHPO-22-98          SIIQESCKQTRLHQAKRVTVSH------LKHAVQSVEQFDFLQDI-----
Q8MLV5|Q8MLV5_DROME-1-66         SLLTKTLRITNARNAKTLSPSH------MRQCIVSEKRFDFLKEL-----
Q8SQT6|Q8SQT6_ENCCU-10-93        EIVGLTLKEARKKSSSRMSSEF------IIRATESDPKFAFLKNMEQFKN
Q20237|Q20237_CAEEL-68-140       KFLQAAAEATQFTSSKTLNPQH------MKQAVLNTPHFSFLESV-----
Q86G95|Q86G95_CAEEL-42-114       KFLQAAAEATQFTSSKTLNPQH------MKQAVLNTPHFSFLESV-----
Q9FHS0|Q9FHS0_ARATH-12-86        FLAEKSAVVTAEKKRKTVNLDHL-----RIAVKRHQPTSDFLLD------
Q9LGS9|Q9LGS9_ORYSA-167-241      SLAAGAHRAASRRGRRAVRAVHV-----RAAAREHRPTADFLLD------
Q9NRG0|CHR1_HUMAN-19-97          CLATYSYRHGSGKEK-KV---LTY--SDLANTAQQSETFQFLADILPKK-
Q9JKP8|CHR1_MOUSE-19-97          YLATCSYRHGSGKAK-KA---LTY--SDLASTAEDSETLQFLADILPKK-
Q9V452|Q9V452_DROME-20-101       HLAGAAYTEEFGQRPGEA---LKY--EHLSQVVNKNKNLEFLLQIVPQKI
Q9LN09|Q9LN09_ARATH-104-188      RFSEEAY-DSSVKDKKKF---IHY--KHLSSVVSNDQRYEFLADSVPEK-
P27344|DPB3_YEAST-6-95           NLVEESLVLAQLNSKGKTSLRLSL--NSIEECVEKRDNFRFLEDAIKQLK
Q851X6|Q851X6_EEEEE-206-257      RFADDAYRNALKDRKK----------------------------------
CONSENSUS                        ELTMRAWMHTEENKRKTLQKSD------IAQAVSKTDTFDFLVDIVPQKE
                                  .                                                

Q13952|CBFC_HUMAN-44-117         -----
Q62725|CBFC_RAT-44-117           -----
O73745|O73745_XENLA-42-115       -----
Q7ZVY3|Q7ZVY3_BRARE-42-115       -----
P70353|CBFC_MOUSE-44-117         -----
O04033|O04033_ARATH-59-132       -----
Q9SNZ0|Q9SNZ0_ARATH-77-155       -----
Q8L4B2|Q8L4B2_ARATH-82-155       -----
Q9ZVL3|Q9ZVL3_ARATH-72-145       -----
O23636|O23636_ARATH-16-89        -----
Q9SGU4|Q9SGU4_ARATH-16-89        -----
Q8VY66|Q8VY66_ARATH-78-151       -----
Q9FMV5|Q9FMV5_ARATH-80-163       IKEEE
Q9SMP0|Q9SMP0_ARATH-67-140       -----
Q8LCG7|Q8LCG7_ARATH-78-150       -----
Q9XE33|Q9XE33_ORYSA-92-165       -----
Q02516|HAP5_YEAST-161-234        -----
O13381|O13381_NEUCR-84-167       -----
Q96WN9|Q96WN9_TRIRE-84-167       -----
O59849|O59849_ASPOR-83-166       -----
P87092|P87092_EMENI-83-166       -----
P79007|PHP5_SCHPO-98-185         -----
Q9W3V9|Q9W3V9_DROME-155-228      -----
Q9FGP7|Q9FGP7_ARATH-56-129       -----
Q8SSZ4|Q8SSZ4_DICDI-272-345      -----
Q8SRY9|Q8SRY9_ENCCU-35-115       -----
Q8IL74|Q8IL74_PLAF7-36-118       R----
Q9FGP6|Q9FGP6_ARATH-37-110       -----
Q9FF42|Q9FF42_ARATH-66-145       -----
O17072|O17072_CAEEL-111-185      -----
Q9FGP8|Q9FGP8_ARATH-64-144       -----
Q8LMX6|Q8LMX6_EEEEE-53-127       -----
Q8W099|Q8W099_ORYSA-45-118       -----
Q93VF0|Q93VF0_ORYSA-45-118       -----
Q9NR33|DPE4_HUMAN-38-112         -----
Q9CQ36|DPE4_MOUSE-37-113         -----
Q8MSF2|Q8MSF2_DROME-52-127       -----
Q9W256|Q9W256_DROME-74-149       -----
Q9NAC5|Q9NAC5_CAEEL-34-109       -----
Q86HI1|Q86HI1_DICDI-80-151       -----
P40096|NCB1_YEAST-51-125         -----
Q13448|Q13448_HUMAN-4-74         -----
Q14919|Q14919_HUMAN-3-86         -----
Q9D6N5|Q9D6N5_MOUSE-3-86         -----
Q7ZVI1|Q7ZVI1_BRARE-3-86         -----
Q9GSP1|Q9GSP1_DROME-3-86         -----
Q9W2E3|Q9W2E3_DROME-3-86         -----
Q8W0W6|Q8W0W6_MAIZE-2-80         -----
Q8W0W7|Q8W0W7_ORYSA-2-80         -----
Q9LHG0|Q9LHG0_ARATH-2-83         -----
Q9C7A7|Q9C7A7_ARATH-16-87        -----
Q10315|YD63_SCHPO-22-98          -----
Q8MLV5|Q8MLV5_DROME-1-66         -----
Q8SQT6|Q8SQT6_ENCCU-10-93        -----
Q20237|Q20237_CAEEL-68-140       -----
Q86G95|Q86G95_CAEEL-42-114       -----
Q9FHS0|Q9FHS0_ARATH-12-86        -----
Q9LGS9|Q9LGS9_ORYSA-167-241      -----
Q9NRG0|CHR1_HUMAN-19-97          -----
Q9JKP8|CHR1_MOUSE-19-97          -----
Q9V452|Q9V452_DROME-20-101       R----
Q9LN09|Q9LN09_ARATH-104-188      -----
P27344|DPB3_YEAST-6-95           -----
Q851X6|Q851X6_EEEEE-206-257      -----
CONSENSUS                        RKEEE