Plant Transcription factor database - Universität Potsdam
version: 3.0

NOZZLE_Angio HMM

Sequence NP_194463 from Arabidopsis thaliana was used as seed in a PSI-BLAST search with 4 iterations. The retrieved sequences, from Arabidopsis thaliana, Vitis vinifera, Brassica juncea and Medicago truncatula, were aligned and used to build a HMM.

CLUSTAL W (1.83) multiple sequence alignment


gb_AAD37775.1   QKKPTLRGMGVAKLERQRIEEEKKQL-AAATVGDTSSVASISNN-----ATRLPVP----
gb_ABC87311.1   QKEPTLRGMGVAKLERFIAEEEKKKMVVVAGEGDTS--AASPNT-----ATRFP------
emb_CAN74467.1  QKKQPQRGMGVAQLERLRVEEWKKMT-GITHLQPMSLPGHFRYQIPYQFAEPPPAPASGQ
gb_ABD32238.1   PKK-PLRGVGVEQLEKQRIAALMKKHFDLPHQQQVLKYGAFSPTGPFQFPQQQMMMNENT
                                                                            

gb_AAD37775.1   VDPG----VVLQGFPS--------SLGS---NRIYCGGVGSGQ---------------VM
gb_ABC87311.1   -DRG----VVLQGFPSYGGGPTNTSLGGYTRSRFLCGGAGSGQ---------------IM
emb_CAN74467.1  VQPG----LGSPGWVP--------RFGG---GGFHGFSGGGGF---------------RV
gb_ABD32238.1   TNNNNNTVLVGSGYVP-----------------FVGSNVGAGWIVPNNQNQNQNNIKNRV
                                                                            

gb_AAD37775.1   IDPVISPWGFVETS------STTHELSSISNPQMFNASSNNRCDTCFKKKRLDGDQNNVV
gb_ABC87311.1   IDPVCSPWGFVETS------A--HELSSIPNPQMYNASSNH-CDTCFKKKRLDGDQ-NVV
emb_CAN74467.1  VDPYRNDGAVGTLT------EASRELSSM--PKM--DCVFDRCDVCFKKKRMNADN----
gb_ABD32238.1   VVGGGNYGSGSLLCSSRNPFEPSKELSSM--PNLHHSQPF---DLCLKKTRLNEEESNVM
                                                                            

gb_AAD37775.1   RSNGGGFSKYTMI--PPPMNG--YDQYLLQSDHHQRSQGFLYDHRIARA-ASVSASSTTI
gb_ABC87311.1   RSNGGGFSKYTMMIPPPPMNG--YDE-LLPPD--QRSQGFFYDQRIARS-A--PAASASF
emb_CAN74467.1  LGXXXGREKYAET---PPINS-XBFLGLDMANDENR------DLSRRRSPM--TATYACY
gb_ABD32238.1   RGAG--------------INT----RNLEAWSNHHYVHDFL-GGYMPQP-Q--PSAYPTH
                                                                            

gb_AAD37775.1   NP--YFNEAT-----NHTG-PMEEFGSYMEGNPRNGSGGVKEYEFFPGKYGERVSV----
gb_ABC87311.1   NP--YFNEAT-----NLTGYSREEFGSV---NPRNGTRGVKEYEFFPGKYDDFHGK----
emb_CAN74467.1  NH----SEDA-----EVVAVHRKGNS--------VNGRIFMEYEFFPGKGEASTSVVGGG
gb_ABD32238.1   HN---LDEYV-----EVVAVHRRGSS-----SSGGKDKVFMEYDFFHEKDGRDTSFKNLK
                                                                            

gb_AAD37775.1   -------------VATTSSLVGDCSP-N---TIDLSLKL
gb_ABC87311.1   -------------SFPVATSVGDCSP-NTSSTIDLSLKL
emb_CAN74467.1  --GGGGEAS---LAIPTAEAATTTSSRNASNVVDLSLKL
gb_ABD32238.1   FPTIGEASSSSSLSLTVSAYGGDNAT-TDLSSIDLSLKL