Plant Transcription factor database - Universität Potsdam
version: 3.0

STER_AP HMM

Alignment based on known members of Arabidopsis thaliana

CLUSTAL W(1.4) multiple sequence alignment


BAB09276.1      MSTSSSSSDNGAGGSGGVFEAPSPSRPRRGANDVWPEPFLESLAVQVAVN
CAA11128.1      MSTSSSSSDNGAGGSGGVFEAPSPSRPRRGANDVWPEPFLESLAVQVAVN
                                                                  

BAB09276.1      ASTSAGLLAAAPALANVFRVCTTWHAVSRSDHLWQLLSRQVWARTHLMHD
CAA11128.1      ASTSAGLLAAAPALANVFRVCTTWLAVSRSDHLWQLLSRQVWARTHLMHD
                                                                  

BAB09276.1      TWRDEFIYRHRTARNFRTRTHTYFTLQFDPSDVDEPDSLSCRCLTLSDLY
CAA11128.1      TWRDEFIYRHRTARNFRTRTHTYFTLQFDPSDVDEPDSLSCRCLTLSDLY
                                                                  

BAB09276.1      LAAGFADGTVRLFLLNNRLHVRTLRPPLRDRFGRFSRAVSGIVISDSRLT
CAA11128.1      LAGGFADGTVRLFLLNNRLHVRTLRPPLRDRFGRFSRAVSGIVISDSRLT
                                                                  

BAB09276.1      FATMDGDIHVAEIDGVGHTRTAYAGDIVNDGALVDFTGCGRWWVGLFAGV
CAA11128.1      FATMDGDIHVAEIDGVGHTRTAYAGDIVNDGALVDFTGCGRWWVGLFAGV
                                                                  

BAB09276.1      PGRAFHIWDCNSEETTFVGGTLTDPEAVMGWHTLTELTTSLGRLRISGNE
CAA11128.1      PGRAFHIWDCNSEETTFVGGTLTDPEAVMGWHTLTELTTSLGRLRISGNE
                                                                  

BAB09276.1      TAVACTRWRIMVIDLRNQGVIIGEDEEQRRGLIVTGFDANDEAYVRLDSR
CAA11128.1      TAVACTRWRIMVIDLRNQGVIIGEDEEPRRGLIVTGFDANDEAYVRLDSR
                                                                  

BAB09276.1      GNASVRRVNTQQTVCEFRVSGAAQRRVMGCVNRLHALMCAGGIMRVWEVE
CAA11128.1      GNASVRRVNTQQTVCEFRVSGAAQRRVMGCVNRLHALMCAGGIMRVWEVE
                                                                  

BAB09276.1      RGEYLYSIRERVGEVDAIVADDRHVAVASASSTAQSIIHLWDFGAL
CAA11128.1      RGEYLYSIRERVGEVDAIVADDRHVAVASASSTAQSIIHLWDFGAL