Plant Transcription factor database - Universität Potsdam
version: 3.0

ULT HMM

Alignment of the two members of this family from Carles et al. (2005).

CLUSTAL W(1.4) multiple sequence alignment


NP_567799.1     EELQEMSGVNVGGDYVEVMCGCTSHRYGDAVARLRVFPTGDLEITCECTP
NP_179677.1     EELQEISGVHVGDDYVEVMCGCTSHRYGDAVARLKIFSDGELQITCQCTP


NP_567799.1     GCDEDKLTPAAFEKHSGRETARKWKNNVWVIIGGEKVPLSKTVLLKYYN
NP_179677.1     ACLEDKLTPAAFEKHSERETSRNWRNNVWVFIEGDKVPLSKTVLLRYYN