Plant Transcription factor database - Universität Potsdam
version: 3.0

VARL HMM

Alignments obtained from Duncan, L. et al. (2007): The VARL gene family and the evolutionary origins of the master cell-type regulatory gene, regA, in Volvox carteri

CLUSTAL W (1.83) multiple sequence alignment


RLS4/13-87      VVGVFHPQLYMKGGDCIEV----NGKMISRGRFEKLAGTATAKWHVSIKVLPSG---TTI
RLS7/13-87      VVGVFYPEIYIKGGDCIEL----NGKMISRGRFEKLAGSATAKWHVSIKVLPSG---TTI
RlsJ/13-87      AVGLFHPQLYLSGGNCIEC----GNEMMSRGKFERLAGTATAKWHVSIKVLPSG---VTL
RlsK/13-87      AVGLFHPQLYLSGGNCIEC----GNEMMSRGKFERLAGTATAKWHVSIKVLPSG---VTL
RLS3/13-87      VYGTFHPGPYLRNKECIEH----DGRMITRGHFERLGGTATAKWHVSIKVMPQN---LAL
RLS5/13-87      VVGVFHVLPYLEGGKCIEY----DGELISRSAFERVGGSTMAKWYRSIKVLPDG---MSL
RLS9/1-75       VVGVFHMKPYMEGGKCIEY----DGELISRSAFERVGGSTMAKWYRSIKVLPEG---VSL
RLS6/13-87      VLGVFYTGAYLDGGRCVEH----CGELLSRSAFERVGGSSMAKWYRSIKVLPDG---MSL
RlsH/13-87      VQGIFHVKPYLEGRKCIDH----GGEMVSRSAFERAGGSMMAKWYRSIKVLPEG---VSL
RLS10/1-61      --------------DCIWW----NNQFVSRSRFEKEGGSTTAKWHCSIKVAGDN---TAL
RlsL/13-88      IQGVFHPERYLANQDCIFY----ENKFISRSAFEKAGGSTTAKWHCSIKVAGTHA--VTL
RLS1/13-87      AVGLFQPQLYLARMDCIRY----KGINVSRSNFEKVGGSNMAKWYRSIRVMPDL---EPL
RlsD/13-87      ACGVFEPALYMSRMDCIRY----HGQLISRSHFEKIGGSNMAKWYRSIRVLPDL---EPL
RlsA/13-87      ACGVFDLTRYLTGRDCVRH----CGRWISRSQFEKVGGSTMAKWYRSIRVLPDL---EPL
RlsC/13-87      VRGRFDVPRYLAGRDCIFH----NGRWMSRSNFERVGGSKMAKWYRSIRVLPDL---EPL
RegA/13-87      ACGVFDVPRYLAGRDCIHN----GSKWMSRSQFEKVGGSKMAKWYRSIRVLPDL---EPL
RlsB/13-87      PVGKFDVPRYIAGRDCIFF----NGRWMSRSHFEKVGGSRMAKWYRSIRVLPDL---EPL
RlsF/13-90      VRGTFHPDLYMCSQDCITF----KGKRIGRSKFEKLGNSSMAKWHRSIRVIREDGELEPL
RLS8/13-87      VVGLFHPDRYLKGGDCIAC----GMGMVSRSRFEKIGGSPMAKWYRSIRVVGSD---EPL
RlsE/13-87      VFGMFYPDRYMVGVDCILV----DGMFVSRSRFEKLGGSLMAKWYRSIRVVDTA---EPL
RlsG/1-75       IYGIFHPDRYLSGEDCIDY----QGNFITRSKFEKLGGSLMAKWYRSIRVVTTD---EPL
RLS11/1-75      VFGVFHFDRYLDNRDCIEH----QGSFLSRSKFEKLGGSVMAKWYRSIRVADTG---EAL
RLS2/13-90      VLGLFHPRRYVEGRDCVEYPPHS-GTFVSRSHFEKVGGAVTAKWYRSIRVLPQM---EHL
RlsI/13-90      VLGVFHPQRYLDMTECIECPPES-GTFITRSHFEKVGGAATAKWYRSIRVLPSL---EHL
RlsM/13-91      VVGLFDPVRYLLRRDCIFLLNCSPNTWVSRSHFERICGCGTAKWYRSIRVLGPM---ETL
RLS12/13-87     AEGYFDPQAYMRREPCVLH----DGEMLLPTKFEKLARSK-QRWTIGVKVLETC---KPI
                                                                            

RLS4/13-87      GKWLQQHGLPV-LQGRPRKRRAA
RLS7/13-87      GKWLQQQGLPV-LQGQPRAKRST
RlsJ/13-87      GKWLQQHGLPI-LQGRPRRRRAD
RlsK/13-87      GKWLQQHGLPI-LQGRPRKRPPL
RLS3/13-87      GKWLASHGLPV-LTGKPRKPRSN
RLS5/13-87      GRWLAAHKLPI-LKGNPRRSFKG
RLS9/1-75       GRWLTSRGLPI-IKGNPRRNQKG
RLS6/13-87      GRWLLARGMPV-LKGNPRQSRRR
RlsH/13-87      GKWLVSNGLPV-LKGNPRRSKKS
RLS10/1-61      GSWLSARGLPV-LKGCARKSKKQ
RlsL/13-88      GSWLNAKGLPV-IKGGSRKSKRQ
RLS1/13-87      GEWLERHGLPV-LKGAARRSRPR
RlsD/13-87      GEWLERHGMPV-TKGPARRYRPR
RlsA/13-87      GEWLERHGMPV-LRGPARRRRRR
RlsC/13-87      GEWLERHGMPV-TKGPARRSSKR
RegA/13-87      GEWLERHGMPV-TKGPARRSRKR
RlsB/13-87      GEWLERNGMPI-TKGPSRRSSRR
RlsF/13-90      GEWLTRHGLPV-LKGKQRISRKR
RLS8/13-87      GSWLTRHGLPV-HTGMGRGRGRK
RlsE/13-87      GAWLERHNLPV-FTGKARQRRQR
RlsG/1-75       GTWLTRRGLPV-LKGTSRNRKQV
RLS11/1-75      GNWLERHGLPV-LRGKPRTRVPK
RLS2/13-90      GDWLEAHGLQV-FKGTGRKRGGR
RlsI/13-90      GSWLARLSLPV-FKGVGRRRHQR
RlsM/13-91      GEWLTRVGLPL-WMGPSRTGPNQ
RLS12/13-87     GDWLQEHGLPLTLRGLRRRPVPG