Plant Transcription factor database - Universität Potsdam
version: 3.0

VOZ HMM

This alignment represent the Domain-B from Mitsuda et al. (2004) which is both a DNA-binding domain and a dimerization domain.

CLUSTAL W(1.4) multiple sequence alignment


BAD87186.1      PVPAAFLRPKCALWDCPRPAQGSERWQDYCSMYHADLAVKEEGPPGTMPV
AAU03115.1      PSPSQYLGPKCALWDCGRPVRGSDECQHYCNPYHAGLALNDDGLLGTRPV
At2g42400.1     VPPSAFLGPKCALWDCTRPAQGSEWYLDYCSNYHGTLALNEDSP-GTAPV
At1g28520.1     PPPSAFLGPKCALWDCPRPAQGFDWFQDYCSSFHAALAFNEGPP-GMNPV
AB164647.1      SPLAAYLHPKCALWDCPRPCRGGNEGTFYCSSFHEELAITEGAP-GMCPV


BAD87186.1      IRPRGIDLKDGPLFAALSAKIQGKHVGIPVCEGAATAKSPWNAPELFDLY
AAU03115.1      MRPRGIDLKDGPLFAALSAKVQGKNVGIPVCEGAATTKSPWNAPELFDLS
At2g42400.1     LRPGGISLKDNLLIDALRAKTQGKNVGIPVCEGAVNTKCPWNAAELFHLE
At1g28520.1     VRPGGIGLKDGLLFAALSAKAGGKDVGIPECEGAATAKSPWNAPELFDLT
AB164647.1      VRPGGIDLKDGPLFAALAARVGGHAVGIPELQGAATSKSPWNATDLFDVA


BAD87186.1      IFEGESIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMKDFG
AAU03115.1      LLEGESLREWLFFDTPRRAFDSGNRKQRSLPDYNGRGWHESRKQVMKDFG
At2g42400.1     LVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQE
At1g28520.1     VLESETLREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQIMVEFG
AB164647.1      VHPGETLREWLFFDKPRRAFESGTRKQRSLPDYGGRGWHESRKQIMKDLG


BAD87186.1      GLKRSYYMDPQPSNSYEWHLYEYEINDCDAFALYRLEFKSSDAKKTA---
AAU03115.1      GLKRSYYMDPQPSSNYEWHLFEYETNDSDALALYRLEYKSSDTKRSV---
At2g42400.1     GQKRSYYMDPQPPGPFEWHLFEYQINESDACALYRLELKVGNGKKSP---
At1g28520.1     GLKRSYYMDPQPLHHFEWHLYEYEINKCDACALYRLELKLVDGKKTS---
AB164647.1      GLKRSYYMDPQPEGLNEWHMYEYEVIACTDCALYRLELKVVDASKRSGKV


BAD87186.1      KSKLACNP-LNEIQQQMVRLSADSP
AAU03115.1      KSKLASSP-LSEIQQQMVRLSADSP
At2g42400.1     KGKISKDP-LADLQKKMG-------
At1g28520.1     KGKVSNDS-VADLQKQMGRLTA---
AB164647.1      KAQAQTDSSVASLQHQIGRLSADLS