Plant Transcription factor database - Universität Potsdam
version: 3.0

trihelix HMM

The trihelix domain is characteristic of the trihelix family. The trihelix domain was extracted from known members of this family in Nicotiana tabacum, Arabidopsis thaliana and Oryza sativa. The multiple alignment obtained was used as seed for a hmm.

CLUSTAL X (1.82) multiple sequence alignment


AtGT-2N-AAM64675        ----WPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMM-ELGYK------------
AtGTL1C-AAM98226        ----WPREETLALLRIRSDMDSTFRDATLKAPLWEHVSRKLL-ELGYK------------
OsGT-2N-BAD25570        ----WPREETLALIRIRSEMDAAFRNATLKAPVWEELSRRLA-ELGYQ------------
N37430-NP_568506        ----WCSDEVLALLRFRSTVENWFP-----EFTWEHTSRKLA-EVGFK------------
AtGT-2C-AAM64675        ----WPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMR-RLGYN------------
OsGT-2C-BAD25570        ----WPKEEVQALIDLRMEKEEQYNDMGPKGPLWEEIAAGMQ-RIGYN------------
AtGTL1N-AAM98226        ----WPKAEILALINLRSGMEPRYQDNVPKGLLWEEISTSMK-RMGYN------------
AB023041-NP_189228      ----WAQDETRTLISLRREMDNLFNTSKSNKHLWEQISKKMR-EKGFD------------
AtGT-1-AAA66473         ----WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMR-EKGFD------------
NtGT-1a-_PQ0446         ----WVQEETRALISLRRELDSLFNTSKSNKHLWDQISLKMR-EKGFD------------
ac003028                ----WSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMR-DKSFP------------
AB007649-AAO42228       ----WKPEEIKKVIRMRGELHSRFQVVKGRMALWEEISSNLS-AEGIN------------
F11B9.6/1-447           REDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNSSHG-NGR---------P
F9F8.9/1-447            REDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNSSHG-NGR---------P
MOP10_9/1-447           REDWWSEEATATLVEAWGNRYVKLNHGNLRQNDWKDVADAVNSRHGDNSR---------K
F14P22.220/1-447        REDCWSEEATFTLIQAWGNRYVDLSRGNLRQKHWQEVANAVNDRHYNTGRNVSAAKSQPY
NtSIP1/1-447            REDCWSEAATHTLVEAWGSHYLELKRGNLRQKYWQEVANAVNALHGHT-------KKQ-Y
                            *       ::                   *.  :  :                   

AtGT-2N-AAM64675        RSSKKCKEKFENVYKYHKRTK
AtGTL1C-AAM98226        RSSKKCKEKFENVQKYYKRTK
OsGT-2N-BAD25570        RSGKKCKEKFENVDKYYKRTK
N37430-NP_568506        RSPQECKEKFEEERRYFNSNN
AtGT-2C-AAM64675        RSAKRCKEKWENINKYFKKVK
OsGT-2C-BAD25570        RSAKRCKEKWENINKYFKKVK
AtGTL1N-AAM98226        RNAKRCKEKWENINKYYKKVK
AB023041-NP_189228      RSPSMCTDKWRNILKEFKKAK
AtGT-1-AAA66473         RSPTMCTDKWRNLLKEFKKAK
NtGT-1a-_PQ0446         RSPTMCTDKWRNLLKEFKKAK
ac003028                RSPEQCKCKWKNLVTRFKGCE
AB007649-AAO42228       RSPGQCKSLWASLIQKYEESK
F11B9.6/1-447           KTDVQCKNRIDTLKKKYKTEK
F9F8.9/1-447            KTDVQCKNRIDTLKKKYKTEK
MOP10_9/1-447           KTDLQCKNRVDTLKKKYKTEK
F14P22.220/1-447        RTDVQCKNRIDTLKKKYKVEK
NtSIP1/1-447            RTDIQCKNRIDTLKKKYKIEK
                        :.   *.         .:  :